SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000101116 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000101116
Domain Number 1 Region: 73-171
Classification Level Classification E-value
Superfamily LCCL domain 3.01e-25
Family LCCL domain 0.00075
Further Details:      
 
Domain Number 2 Region: 26-69
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000102
Family Spermadhesin, CUB domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000101116   Gene: ENSMUSG00000019891   Transcript: ENSMUST00000105476
Sequence length 432
Comment pep:known chromosome:GRCm38:10:52233637:52321378:1 gene:ENSMUSG00000019891 transcript:ENSMUST00000105476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTGAGGPSVLALLFAVCAPLRLQAEELGPYCGSWAVPKELRLNSNEVTVLFKSGSHISG
RGFLLTYASSDHPDLITCLERGSHYFEEKYSKFCPAGCRDIAGDISGNTKDGYRDTSLLC
KAAIHAGIITDELGGHINLLQSKGISHYEGLLANGVLSRHGSLSEKRFLFTTPGMNITTV
AIPSVIFIALLLTGMGIFAICRKRKKKGNPYVSADAQKTGCWKQIKYPFARHQSTEFTIS
YDNEKEMTQKLDLITSDMADYQQPLMIGTGTVARKGSTFRPMDTDTEEVRVNTEASGHYD
CPHRPGRHEYALPLTHSEPEYATPIVERHLLRAHTFSTQSGYRVPGPRPTHKHSHSSGGF
PPATGATQVESYQRPASPKPVGGGYDKPAASSFLDSRDPASQSQMTSGGDDGYSAPRNGL
APLNQTAMTALL
Download sequence
Identical sequences XP_006512883.1.92730 ENSMUSP00000101116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]