SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000101137 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000101137
Domain Number 1 Region: 4-169
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-41
Family Nuclear receptor ligand-binding domain 0.000092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000101137   Gene: ENSMUSG00000019803   Transcript: ENSMUST00000105498
Sequence length 173
Comment pep:putative chromosome:GRCm38:10:42563272:42568828:-1 gene:ENSMUSG00000019803 transcript:ENSMUST00000105498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLMLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNTDNTDSQKLNKIISEIQALQEVV
ARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTR
YPTQPCRFGKLLLLLPALRSISPSTIEEVFFKKTIGNVPITRLLSDMYKSSDI
Download sequence
Identical sequences Q3UXE8
ENSMUSP00000101137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]