SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000101578 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000101578
Domain Number 1 Region: 146-268
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 9.42e-30
Family Troponin T 0.000039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000101578   Gene: ENSMUSG00000061723   Transcript: ENSMUST00000105958
Sequence length 272
Comment pep:known chromosome:GRCm38:7:142498864:142516007:1 gene:ENSMUSG00000061723 transcript:ENSMUST00000105958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDEETEQVEEQYEEEEEAQEEEVQEEAPEPEEVQEDAVAEEEREEDEEEEKPRPKLTAP
KIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEELIALKERIEKRRAERAEQ
QRIRAEKERERQNRLAEEKARREEEDAKRRAEDDMKKKKALSSMGANYSSYLAKADQKRG
KKQTAREMKKKILAERRKPLNIDHLSDDKLRDKAKELWDTLYQLETDKFEFGEKLKRQKY
DIMTVRARVEMLAKFSKKAGATAKGKVGGRWK
Download sequence
Identical sequences A0A0R4J1B0
ENSMUSP00000101565 NP_001157137.1.92730 XP_021055297.1.100879 ENSMUSP00000101578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]