SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000101922 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000101922
Domain Number 1 Region: 1-138
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 7.72e-50
Family Inorganic pyrophosphatase 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000101922   Gene: ENSMUSG00000028013   Transcript: ENSMUST00000106315
Sequence length 152
Comment pep:putative chromosome:GRCm38:3:133348076:133378067:1 gene:ENSMUSG00000028013 transcript:ENSMUST00000106315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDVVHVKILGTLALIDQSETDWKIIAINVNDPEAEKFHDIDDVKKFKPGYLEATLNWFRL
YKVPDGKPENKFAFNGEFKNKAFALDVINSAHERWKEMVMKKCDKGAISCVNVHICDSPF
HCTMEEARSLVESVPTPSMNKESNVEGTECLL
Download sequence
Identical sequences G8JL76
ENSMUSP00000101922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]