SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102104 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102104
Domain Number 1 Region: 55-196
Classification Level Classification E-value
Superfamily SH2 domain 1.04e-31
Family SH2 domain 0.0000029
Further Details:      
 
Domain Number 2 Region: 2-77
Classification Level Classification E-value
Superfamily SH3-domain 5.34e-21
Family SH3-domain 0.0000364
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102104   Gene: ENSMUSG00000059923   Transcript: ENSMUST00000106495
Sequence length 203
Comment pep:novel chromosome:GRCm38:11:115644650:115708576:-1 gene:ENSMUSG00000059923 transcript:ENSMUST00000106495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPW
FFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFL
WVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQMPQEDGELGFRRGDFIHVMDNSDPNWW
KGACHGQTGMFPRNYVTPVNRNV
Download sequence
Identical sequences B1AT92
ENSMUSP00000102104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]