SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102287 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102287
Domain Number 1 Region: 14-62
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.83e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000833
Further Details:      
 
Domain Number 2 Region: 119-169
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000358
Family cAMP-binding domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102287   Gene: ENSMUSG00000020612   Transcript: ENSMUST00000106676
Sequence length 171
Comment pep:known chromosome:GRCm38:11:109650575:109661753:1 gene:ENSMUSG00000020612 transcript:ENSMUST00000106676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGSMATSEEERSLRECELYVQKHNIQALLKDSIVQLCTTRPERPMAFLREYFERLEKE
EARQIQCLQKTGIRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPK
DYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGKGC
Download sequence
Identical sequences A2AI69
ENSMUSP00000102287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]