SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102312 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102312
Domain Number 1 Region: 25-135
Classification Level Classification E-value
Superfamily SCP-like 6.62e-38
Family Sterol carrier protein, SCP 0.00000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102312   Gene: ENSMUSG00000028603   Transcript: ENSMUST00000106701
Sequence length 143
Comment pep:known chromosome:GRCm38:4:108044550:108071419:-1 gene:ENSMUSG00000028603 transcript:ENSMUST00000106701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFPEAASSFRTHQVSAAPTSSAGDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVK
DGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDLLALMTGKMNPQSAFFQGKLK
IAGNMGLAMKLQNLQLQPGKAKL
Download sequence
Identical sequences ENSMUSP00000102312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]