SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102333 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102333
Domain Number 1 Region: 724-800,834-923
Classification Level Classification E-value
Superfamily RUN domain-like 7.45e-36
Family RUN domain 0.0021
Further Details:      
 
Domain Number 2 Region: 1083-1256
Classification Level Classification E-value
Superfamily RUN domain-like 1.83e-26
Family RUN domain 0.014
Further Details:      
 
Domain Number 3 Region: 931-1028
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 3.08e-18
Family Lipoxigenase N-terminal domain 0.04
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000102333
Domain Number - Region: 610-683
Classification Level Classification E-value
Superfamily SAICAR synthase-like 0.0458
Family Inositol polyphosphate kinase (IPK) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102333   Gene: ENSMUSG00000035901   Transcript: ENSMUST00000106722
Sequence length 1263
Comment pep:novel chromosome:GRCm38:7:109893780:109960400:-1 gene:ENSMUSG00000035901 transcript:ENSMUST00000106722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGGGGGGSAPSRFADYFVICGLDTETGLEPDELSGENFEQTPLRRTFKSKVLARYPEN
VDWNPFDQDAVGMLCMPKGLAFKTQADPREPQFHAFIITREDGSRTFGFALTFYEEVTSK
QICSAMQTLYHMHNAEYDVLHAPLADGGDQSGMEDGEGIPGTKLQRFNSYDISRDTLYVS
KCICLITPMSFMKACRSVLQQLHQAVTSPQPPPLPLESYIYNVLYEVPLPPPGRSLKFSG
VYGPIICQRPSTNELPLFDFPVKEVFELLGVENVFQLFTCALLEFQILLYSQHYQRLMTV
AETITALMFPFQWQHVYVPILPASLLHFLDAPVPYLMGLHSNGLDDRSKLELPQEANLCF
VDVDNHFIELPEDLPQFPNKLEFVQEVSEILMAFGVPPEGNLHCSESASKLKRIRASELV
SDKRNGNIAGSPLHSYELLKENETIARLQALVKRTGVSLEKLEVREDPSSNKDFKVQCDE
EELRIYQLNIQIREVFANRFTQMFADYEVFVIQPSQDKESWFTNREQMQNFDKASFLSDQ
PEPYLPFLSRFLETQMFASFIDNKIMCHDDDDKDPVLRVFDSRVDKIRLLNVRTPTLRTS
MYQKCTTVDEAEKAIELRLAKIDHTAVHPHLLDMKIGQGKYEPGFFPKLQSDVLCTGPAS
NKWTKRNAPAQWRRKDRQKQHTEHLRLDNDQREKYIQEARNMGSTIRQPKLSNLSPSVIA
QTNWKFVEGLLKECRNKTKRMLVEKMGREAVELGHGEVNITGVEENTLIASLCDLLERIW
SHGLQVKQGKSALWSHLLHYQENRQRKLTSGSLSTSGILLDSERRKSDASAVMSPLRISL
IQDMRHIQNIGEIKTDVGKARAWVRLSMEKKLLSRHLKQLLSDHELTKKLYKRYAFLRCD
DEKEQFLYHLLSFNAVDYFCFTNVFTTILIPYHILIVPSKKLGGSMFTANPWICISGELG
ETQILQIPRNVLEMTFECQNLGKLTTVQIGHDNSGLYAKWLVECVMVRNEVTGHTYKFPC
GRWLGKGMDDGSLERVLVGELLTSLPEVDERPCRTPPLQQSPSVIRRLVTISPNNKPKLN
TGQIQESIGEAVNGIVKHFHKPEKERGSLTLLLCGECGLVSALEQAFQHGFKSPRLFKNV
FIWDFLEKAQTYYETLEQNDVVPEENWHTRARNFCRFVTAVNNTPRNIGKDGKFQMLVCL
GARDHLLHHWIALLADCPITAHMYEDVALIKDHTLVNSLIRVLQTLQEFNITLDTSLVKG
IDI
Download sequence
Identical sequences A0A0R4J1B6
ENSMUSP00000102333 NP_001298068.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]