SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102343 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102343
Domain Number 1 Region: 331-591
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-54
Family YWTD domain 0.0000000202
Further Details:      
 
Domain Number 2 Region: 162-199
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 3 Region: 39-75
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 4 Region: 78-116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000942
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 5 Region: 247-292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000167
Family EGF-type module 0.0023
Further Details:      
 
Domain Number 6 Region: 115-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000458
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 7 Region: 283-322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000583
Family EGF-type module 0.0014
Further Details:      
 
Domain Number 8 Region: 204-242
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 9 Region: 601-642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000183
Family EGF-type module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102343   Gene: ENSMUSG00000028613   Transcript: ENSMUST00000106732
Sequence length 870
Comment pep:novel chromosome:GRCm38:4:107802413:107872346:1 gene:ENSMUSG00000028613 transcript:ENSMUST00000106732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRPELGALRPLALLLLLLLQLQHLSAADPLPGGQGPVKECEEDQFRCRNERCIPLVWRC
DEDNDCSDNSDEDDCPKRTCADSDFTCDNGHCIPERWKCDGEEECPDGSDESKATCSSEE
CPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCPTSAPGPCRENEFQCGDGTCVLA
IKRCNQERDCPDGSDEAGCLQESTCEGPRRFQCKSGECVDGGKVCDDQRDCRDWSDEPQK
VCGLNECLHNNGGCSHICTDLKIGFECTCPAGFQLLDQKTCGDIDECQDPDACSQICVNY
KGYFKCECHPGYEMDTLTKNCKAVAGKSPSLIFTNRHEVRRIDLVKRDYSRLIPMLKNVV
ALDVEVATNRIYWCDLSYRKIYSAHMDKASIPDEQVVLIDEQLHSPEGLAVDWVHKHIYW
TDSGNKTISVATTDGRRRCTLFSRELSEPRAIAVDPLRGFMYWSDWGFQAKIEKAGLNGA
DRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQLSSIDFNGGNRKMLIFSTDFLSHPFG
VAVFEDKVFWTDLENEAIFSANRLNGLEIAILAENLNNPHDIVIFHELKQPKAADACDLS
AQPNGGCEYLCLPAPQISSHSPKYTCACPDTMWLGPDMKRCYRAPQSTSTTTLASAMTRT
VPATTRAPGTTIHDPTYQNHSTETPSQTAAAPHSVNVPRAPSTSPSTPSPATSNHSQHYG
NEGSQMGSTVTAAVIGVIVPIVVIALLCMSGYLIWRNWKRKNTKSMNFDNPVYRKTTEEE
EEDELHIGRTAQIGHVYPAAISNYDRPLWAEPCLGETRDLEDPAPALKELFVLPGEPRSQ
LHQLPKNPLSELPVVKCKRVALSLEDDGLP
Download sequence
Identical sequences B1AXJ3
NP_001074395.1.92730 ENSMUSP00000102343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]