SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102344 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102344
Domain Number 1 Region: 416-676
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-54
Family YWTD domain 0.0000000202
Further Details:      
 
Domain Number 2 Region: 39-75
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 3 Region: 250-286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.0007
Further Details:      
 
Domain Number 4 Region: 159-195
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 285-325
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 6 Region: 199-235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 78-116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000916
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 8 Region: 115-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000038
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 9 Region: 327-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family EGF-type module 0.0019
Further Details:      
 
Domain Number 10 Region: 360-407
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family EGF-type module 0.0014
Further Details:      
 
Domain Number 11 Region: 686-727
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000019
Family EGF-type module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102344   Gene: ENSMUSG00000028613   Transcript: ENSMUST00000106733
Sequence length 896
Comment pep:novel chromosome:GRCm38:4:107802277:107872816:1 gene:ENSMUSG00000028613 transcript:ENSMUST00000106733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRPELGALRPLALLLLLLLQLQHLSAADPLPGGQGPVKECEEDQFRCRNERCIPLVWRC
DEDNDCSDNSDEDDCPKRTCADSDFTCDNGHCIPERWKCDGEEECPDGSDESKATCSSEE
CPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCPTLCAPHEFQCSNRSCLASVFVC
DGDDDCGDGSDERGCSDPACPPREFRCGGGGTCIPERWVCDRQFDCEDRSDEAAELCGRA
GQGTTATPAACAPTAQFTCRSGECIHLGWRCDGDRDCKDKSDEADCSPGPCRENEFQCGD
GTCVLAIKRCNQERDCPDGSDEAGCLQGLNECLHNNGGCSHICTDLKIGFECTCPAGFQL
LDQKTCGDIDECQDPDACSQICVNYKGYFKCECHPGYEMDTLTKNCKAVAGKSPSLIFTN
RHEVRRIDLVKRDYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAHMDKASIPDEQ
VVLIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATTDGRRRCTLFSRELSEPRAIAVD
PLRGFMYWSDWGFQAKIEKAGLNGADRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQL
SSIDFNGGNRKMLIFSTDFLSHPFGVAVFEDKVFWTDLENEAIFSANRLNGLEIAILAEN
LNNPHDIVIFHELKQPKAADACDLSAQPNGGCEYLCLPAPQISSHSPKYTCACPDTMWLG
PDMKRCYRAPQSTSTTTLASAMTRTVPATTRAPGTTIHDPTYQNHSTETPSQTAAAPHSV
NVPRAPSTSPSTPSPATSNHSQHYGNEGSQMGSTVTAAVIGVIVPIVVIALLCMSGYLIW
RNWKRKNTKSMNFDNPVYRKTTEEEEEDELHIGRTAQIGHVYPARVALSLEDDGLP
Download sequence
Identical sequences B1AXJ5
XP_011238764.1.92730 ENSMUSP00000102344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]