SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102664 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102664
Domain Number 1 Region: 3-224
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.56e-55
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0028
Further Details:      
 
Domain Number 2 Region: 313-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000123
Family FAD/NAD-linked reductases, N-terminal and central domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102664   Gene: ENSMUSG00000028088   Transcript: ENSMUST00000107049
Sequence length 533
Comment pep:known chromosome:GRCm38:3:97628857:97652604:1 gene:ENSMUSG00000028088 transcript:ENSMUST00000107049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKRIAVIGAGASGLTCIKCCLEEGLEPVCFERSGDIGGLWRFQEAPEEGRASIYQSVV
INTSKEMMCFSDYPIPDHYPNYMHNSQVLEYFRMYAKEFDLLKYIQFKTTVCSVKKQPDF
STSGQWQVVTECEGKQQVDVFDGVLVCTGHHTDAHLPLESFPGIEKFKGKYFHSRDYKNP
VEFTGKRVIVIGIGNSGGDLAVEISHTAKQVFLSTRRGAWILNRVGKHGYPIDLLLSSRI
MYYLSRICGPSLKNNYMEKQMNQRFDHEMFGLKPKHRALSQHPTVNDDLPNRIIAGLVKV
KGNVKEFTETAAVFEDGSREDGIDVVIFATGYSFAFPFLEDSVKVVKNKVSLYKKVFPPN
LEKPTLAIIGLIQPLGAIMPISELQGRWATQVFKGLKKLPSQSEMMAEINKAREEMAKRY
VDSQRHTIQGDYIDTMEEIADLVGVRPNILPLVFTDPRLALRLLLGPCTPVQYRLQGPGK
WAGARKTILTTEDRVRKPLMTRVVERDSSGGSLVTVRVLMLAVAFFAVILAYF
Download sequence
Identical sequences P97872
ENSMUSP00000029729 ENSMUSP00000102664 ENSMUSP00000102665 ENSMUSP00000029729 NP_001155235.1.92730 NP_001155237.1.92730 NP_034362.2.92730 XP_006501058.1.92730 10090.ENSMUSP00000102665 ENSMUSP00000029729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]