SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102719 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102719
Domain Number 1 Region: 26-193
Classification Level Classification E-value
Superfamily RUN domain-like 3.4e-43
Family RUN domain 0.0000524
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102719   Gene: ENSMUSG00000006575   Transcript: ENSMUST00000107102
Sequence length 405
Comment pep:novel chromosome:GRCm38:11:102393403:102401754:1 gene:ENSMUSG00000006575 transcript:ENSMUST00000107102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASFVQTTMALGLPSKKASSRNVIVERRNLITVCRFSVKTLLEKYTAEPIDDSSEEFVN
FAAILEQILSHRFKACAPAGPASWFSSDGQRGFWDYIRLACSKVPNNCVSSIENMENIST
ARAKGRAWIRVALMEKRMSEYITTALRDNRTTRRFYDSGAIMLREEATVLTGMLIGLSAI
DFSFCLKGEVLDGKTPVVIDYTPYLKFTQSYDYLTDEEERHSAESSTSEDNSPEHPYLPL
VTDEDSWYNKWHKMEQKFRIVYAQKGYLEELVRLRESQLKDLEAENRRLQLQLEEAAAQN
QREKRELEGVILELQEQLTGLIPGDHAPLAQGSKELTTSLVNQWPSLSTLHRPEGASNSK
LYRRHSFMSTEPLSAEASLSSDSQRLGEAKRDEEPWGPIGSSEPN
Download sequence
Identical sequences XP_006533756.1.92730 ENSMUSP00000102719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]