SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102785 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102785
Domain Number 1 Region: 131-205
Classification Level Classification E-value
Superfamily PDZ domain-like 1.12e-16
Family PDZ domain 0.0019
Further Details:      
 
Domain Number 2 Region: 67-118
Classification Level Classification E-value
Superfamily L27 domain 0.00000000000000942
Family L27 domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102785   Gene: ENSMUSG00000052373   Transcript: ENSMUST00000107167
Sequence length 231
Comment pep:putative chromosome:GRCm38:11:102017336:102026937:-1 gene:ENSMUSG00000052373 transcript:ENSMUST00000107167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVLSEDSGLHETLALLTSQLRPDSNHREEMGFLRDVFSEKSLSYLMKIHEKLRYYERQS
PTPVLHSAMALAEDVMEELQAASVHSDERELLQLLSTPHLRAVLMVHDTVAQKNFDPVLP
PLPDNIDEDFEEESVKIVRLVKNKEPLGATIRRDEHSGAVVVARIMRGGAADRSGLVHVG
DELREVNGIAVLHKRPDEISQILVCIAYLQGGRSSETQSRGLPRARADLFI
Download sequence
Identical sequences B1AQF7
ENSMUSP00000102785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]