SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102878 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102878
Domain Number 1 Region: 210-365
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.92e-31
Family AlaX-like 0.025
Further Details:      
 
Domain Number 2 Region: 2-111
Classification Level Classification E-value
Superfamily HSP20-like chaperones 1.11e-21
Family Co-chaperone p23-like 0.00016
Further Details:      
 
Domain Number 3 Region: 152-210
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000332
Family AlaX-M N-terminal domain-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102878   Gene: ENSMUSG00000097239   Transcript: ENSMUST00000107257
Sequence length 525
Comment pep:novel chromosome:GRCm38:11:101406664:101424519:-1 gene:ENSMUSG00000097239 transcript:ENSMUST00000107257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFCVEDSTDVSVLIEDHRVVFSCRNGDGVELYNEIEFYAKVNSKDSQDKRSGRSITCFV
RKWKEKVAWPRLTKEDIKPVWLSVDFDNWRDWEGDDEVELAQVEHYAELLNKVSTKRPPP
AMDDLDFTTTVVSCSPAELQTDASGGKKEVLSGFHVVLEDTLLFPEGGGQPDDRGTINDI
SVLRVTRRGAQADHFTESPLSPGSQVQVRVDWERRFDHMQQHSGQHLITAVADLLFGLKT
TSWELGRLRSVIELDSPSVTAEQVAAIEQSVNQKIRDRLPVSVRELSLDDPEVEQVRGRG
LPDDHAGPIRVVTIEGVDSNMCCGTHVSNLSDLQVIKILGTEKGKKNKSNLIFLAGNRVL
KWMERSHGSEKALTSLLKCGVEDHVEAVKKLQNATKLLQKNNLNLLRDLAVHTAHSLRSS
PAWGGVVTLHRKEGDSEFMNIIANEIGSEETLLFLTVGDEKGAGLFLLAGPAEAVETLGP
RVAEVLEGKGAGKKGRFQGKATKMSRRAEAQALLQDYVSTQSAEE
Download sequence
Identical sequences A2A4P3
ENSMUSP00000102878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]