SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102880 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102880
Domain Number 1 Region: 228-383
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.19e-31
Family AlaX-like 0.025
Further Details:      
 
Domain Number 2 Region: 4-111
Classification Level Classification E-value
Superfamily HSP20-like chaperones 9.21e-28
Family Co-chaperone p23-like 0.0000662
Further Details:      
 
Domain Number 3 Region: 170-228
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000035
Family AlaX-M N-terminal domain-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102880   Gene: ENSMUSG00000097239   Transcript: ENSMUST00000107259
Sequence length 543
Comment pep:novel chromosome:GRCm38:11:101406839:101424796:-1 gene:ENSMUSG00000097239 transcript:ENSMUST00000107259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERQPARTLWYDRPKYVFMEFCVEDSTDVSVLIEDHRVVFSCRNGDGVELYNEIEFYAKV
NSKDSQDKRSGRSITCFVRKWKEKVAWPRLTKEDIKPVWLSVDFDNWRDWEGDDEVELAQ
VEHYAELLNKVSTKRPPPAMDDLDFTTTVVSCSPAELQTDASGGKKEVLSGFHVVLEDTL
LFPEGGGQPDDRGTINDISVLRVTRRGAQADHFTESPLSPGSQVQVRVDWERRFDHMQQH
SGQHLITAVADLLFGLKTTSWELGRLRSVIELDSPSVTAEQVAAIEQSVNQKIRDRLPVS
VRELSLDDPEVEQVRGRGLPDDHAGPIRVVTIEGVDSNMCCGTHVSNLSDLQVIKILGTE
KGKKNKSNLIFLAGNRVLKWMERSHGSEKALTSLLKCGVEDHVEAVKKLQNATKLLQKNN
LNLLRDLAVHTAHSLRSSPAWGGVVTLHRKEGDSEFMNIIANEIGSEETLLFLTVGDEKG
AGLFLLAGPAEAVETLGPRVAEVLEGKGAGKKGRFQGKATKMSRRAEAQALLQDYVSTQS
AEE
Download sequence
Identical sequences A2A4P4
ENSMUSP00000091465 ENSMUSP00000102880 ENSMUSP00000102880 10090.ENSMUSP00000102880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]