SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000103103 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000103103
Domain Number 1 Region: 162-299,407-660
Classification Level Classification E-value
Superfamily Ras GEF 3.14e-89
Family Ras GEF 0.00021
Further Details:      
 
Domain Number 2 Region: 307-415
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.1e-33
Family Ras-binding domain, RBD 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000103103   Gene: ENSMUSG00000038020   Transcript: ENSMUST00000107479
Sequence length 662
Comment pep:known chromosome:GRCm38:11:98836785:98853697:1 gene:ENSMUSG00000038020 transcript:ENSMUST00000107479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPLEKFLKKQTSQLAGRAVTGGPGGGPGCCGGPGGGGGPGGGGGPAGGLRPLQRRQSVS
RLLLPAFLREPPTEPGLEPPVEEEGGEPLGVSEEPGSGGPCWLQLEEVPGPGPIGSGVPL
RSPSSYSSDELSPGEPLASPPWAPLGAPERPEHLLNRVLERLAGGTTRDSSASDILLDDI
VLTHSLFLPTEKFLQELHQYFVQSRNVEGPEGLGRKQACLALLLHFLDTYQGLLQEEEGA
GHIIKELYLLIMKDESLYQDLREDTLRLHQLVETVELKIPEESQPPSKQVKPLFRHFRRI
DSCLQTRVAFRGSDEIFCRVYMPDHSYVTIRSRLSASVQDILGSVTEKLQYSEEPAERED
ALILVAVASSGEKVLLQPTEDCVFTTLGINSHLFACTRDSYEALVPLPEEVQVSPGDTEI
HRVEPEDVANHLTAFHWELFRCVHELEFVDYVFHGERGRRETANLELLLQRCSEVTHWVA
TEVLLCEAPGKRVQLLKKFIKIAAICKQNQDLLSFYAVVMGLDNAAVSRLRLTWEKLPGK
FKNLFRKFEGLTDPCRNHKSYREVISKMKPPLIPFVPLILKDLTFLHEGSKTLVDGLVNI
EKLHSVAEKVRTIRKYRSRPLCLDMEASPHHLQTKAYVRQFQVIDNQNHLFELSYKLEAN
SQ
Download sequence
Identical sequences Q68EF8
NP_001074394.1.92730 10090.ENSMUSP00000103104 ENSMUSP00000103103 ENSMUSP00000103103 ENSMUSP00000103103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]