SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000103483 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000103483
Domain Number - Region: 105-158
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.00772
Family C-terminal domain of PLC-beta 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000103483   Gene: ENSMUSG00000028478   Transcript: ENSMUST00000107851
Sequence length 248
Comment pep:known chromosome:GRCm38:4:44012678:44032846:1 gene:ENSMUSG00000028478 transcript:ENSMUST00000107851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP
GPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISEVDRLQSEPESIRKWREEQTER
LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRVADEAFYKQPFADLIGYV
TNINHPCYSLEQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLIS
LKQAPLVH
Download sequence
Identical sequences B1AWD9
10090.ENSMUSP00000103483 ENSMUSP00000103481 ENSMUSP00000103483 ENSMUSP00000103483 NP_001073854.1.92730 XP_006537650.1.92730 XP_021077599.1.100879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]