SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000103491 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000103491
Domain Number 1 Region: 46-89
Classification Level Classification E-value
Superfamily Carbonic anhydrase 0.000000000333
Family Carbonic anhydrase 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000103491   Gene: ENSMUSG00000056158   Transcript: ENSMUST00000107859
Sequence length 103
Comment pep:known chromosome:GRCm38:11:93098404:93368999:1 gene:ENSMUSG00000056158 transcript:ENSMUST00000107859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLC
SVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKDCSVMEVLEE
Download sequence
Identical sequences Q9CZQ3
ENSMUSP00000103491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]