SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000103493 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000103493
Domain Number 1 Region: 46-156
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.36e-28
Family Carbonic anhydrase 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000103493   Gene: ENSMUSG00000056158   Transcript: ENSMUST00000107861
Sequence length 169
Comment pep:known chromosome:GRCm38:11:93098404:93491923:1 gene:ENSMUSG00000056158 transcript:ENSMUST00000107861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLC
SVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGG
PMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVCAPAKVLRHRANL
Download sequence
Identical sequences Q3TRQ4
ENSMUSP00000103493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]