SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000103711 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000103711
Domain Number 1 Region: 2-137
Classification Level Classification E-value
Superfamily Carbonic anhydrase 4.97e-41
Family Carbonic anhydrase 0.000000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000103711   Gene: ENSMUSG00000000805   Transcript: ENSMUST00000108076
Sequence length 164
Comment pep:putative chromosome:GRCm38:11:84964347:84966044:1 gene:ENSMUSG00000000805 transcript:ENSMUST00000108076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XMHIVHKKLTSSKEDSKDKFAVLAFMIEVGDKVNKGFQPLVEALPSISKPLRESSLQDML
PPSTKMYTYFRYNGSLTTPNCDETVIWTVYKQPIKIHKNQFLEFSKNLYYDEDQKLNMKD
NVRPLQPLGKRQVFKSHAPGQLLSLPLPTLLVPTLTCLVANFLQ
Download sequence
Identical sequences F6ST32
ENSMUSP00000103711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]