SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000104037 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000104037
Domain Number 1 Region: 934-1064
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000569
Family GAF domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000104037
Domain Number - Region: 772-813
Classification Level Classification E-value
Superfamily EF-hand 0.000518
Family Calbindin D9K 0.077
Further Details:      
 
Domain Number - Region: 158-249,775-817
Classification Level Classification E-value
Superfamily EF-hand 0.00124
Family Calbindin D9K 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000104037   Gene: ENSMUSG00000050944   Transcript: ENSMUST00000108400
Sequence length 1406
Comment pep:known chromosome:GRCm38:11:77089915:77188968:-1 gene:ENSMUSG00000050944 transcript:ENSMUST00000108400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMQVEKKKLLSQADIPTKFDPINYLGEYLMRHNTHYIKDPGVSGYQRVMKEITEELKTH
VPDTINNRISKMKEKVKEKREQREYISTVKVKVAGMRKQALEEQFNEWVLNPKGMIPIVV
YISSYITDLKSEVFEEFLKHLCHSAEEFREIILTDMRRQMFAELFLQCDSGKVMALDRQR
TLALLEAFYDQCSSTTRSLLRNPRQWPFVEFEEIELIEFWGDMDIKKHIYEDFDALLLKM
NMLVAEKLAGKLAENKDLPQQQRDQELSSDSTTEPETATQLTSQQRSRRVSLTGQGQGKG
PRKTSASKQGASRGSVAEQGSRRSSGVNQTQQRGSVAEQGSRRSSAVEQTQQRGSVAEQG
SRRSSTVEQTRQRGSVAEQGSRRSSTVEQTQRRGSVAEQGSRRSSGVNQTQQRGSVAEQG
SRRSSAVEQTQQRGSVAEQGSRRSSAMEQEPQTAQDPNSDSLPEQESHRGSITEGSHRGS
ISEPGQRRASVTGQRRKSSVDDSGSAGSRRGSGTDQGQHRGSVGQRKGSGERKMSASEYG
PHQESITEEPLTASEPGPQIDTIQELDEDSTPQLEDDSALKESKTSELTKIETQEEKPLL
LINEEQVPRDSKQPEVPTSSKKERPSGSPKKGRLSGTSKRDSQKDKACEPKPQHVEGKKW
SGEFLICDWKIKHVKSEEEEQAKLICDDTRFTDLHATIRNFQTYKGIKGRSAFNGVSLDL
LQFVQLLETFVGEDTSFSLSKDLASFFQKNYSETKQEKIKALEQARQNSSRIRRRILLQA
IFEKWDNDGSGFLDLNEVDDLLYTYKEGMERESMKKAKLHINFPEPSPGHEVKLSSKQFQ
RYIELVVSELRGNEDEVLESVVEFLMGSLERSHVEGLRNCARRKWLHQIQYAAETSGVSL
EPVYTETFRVLTQDAEAHGNKKISAHISLLEENVFLPERGHVLLRNVACTLDDAPFVLNK
VLYRDMKGISFTVVDEGKPIHVPQVQHHGNIFFWNSFRSKNEYNGSFLALPLQDAYMRIF
GVLAVDTLRDPHEINIFLPHEIKFYQGVANAFSTAYHHVHSREHVLHSVMTGIRWLFSVT
SGITTITTCFIEPSSEQEDYVLRNMMVTDCLGLAEIHTDPPTITRNACIFRDFLFKCTDT
SEVILASSGGETHIAIPLRQRTKEAMGILDVNIGRSRMLLYQEYKDLQKMVKMIQNVSYE
ILGEFSGEIEKTMVIEMESAGEVKRAGILFFRTMLQELQECLCLLDSMDFVSLLLYEHKY
HVDSILQDITLQEVEANVALVHDVLKGVILFSQREKDSLSDLEEWEKWKFHINKYLVEEI
CVLDPTASNVEVNVELVTSYIQAHSRTEVWNFRNIVIELLYHWINICLTLIELNMRQDVS
IIPPLPKKSATSIYAISSERSIREKL
Download sequence
Identical sequences A0JP43
ENSMUSP00000104037 NP_795939.2.92730 10090.ENSMUSP00000104037 ENSMUSP00000104037 ENSMUSP00000104037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]