SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000104522 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000104522
Domain Number 1 Region: 95-261,557-775,829-869
Classification Level Classification E-value
Superfamily Ras GEF 1.31e-107
Family Ras GEF 0.00011
Further Details:      
 
Domain Number 2 Region: 242-329
Classification Level Classification E-value
Superfamily PDZ domain-like 3.33e-19
Family PDZ domain 0.006
Further Details:      
 
Domain Number 3 Region: 4-97
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000000262
Family cAMP-binding domain 0.0017
Further Details:      
 
Domain Number 4 Region: 467-546
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000999
Family Ras-binding domain, RBD 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000104522   Gene: ENSMUSG00000037533   Transcript: ENSMUST00000108894
Sequence length 1131
Comment pep:known chromosome:GRCm38:11:54622366:54688104:1 gene:ENSMUSG00000037533 transcript:ENSMUST00000108894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRRELCSVMVFEVVEQAGAVILEDGQELDSWYVILNGTVEISHPDGKIENLFMGNSFG
IVPTLDKQHMHGAVRTKVDDCQFVCIAQQDYWRILNHVEKNTHKVEEEGEIVMVHEHREL
DRSGTRKGHIVIKATPERLIMHLIEEHSIVDPTYIEDFLLTYRTFLETPLDVGIKLLEWF
KIDNLRDKVTRIVLLWVNNHFNDFEGDPAMTQFLEEFERNLEDTKMNGHLRLLNIACAAK
AKWRQVVLQKASRESPLHFCLTGGSEKGFGVFVEEVESGSKAADAGLKRGDQVMEVNGQN
FENITLAKALEILRNNTHLALTVKTNIFVFKELLSRTEQEKSGVPHIPKIAEKKSNRHSI
QDVPGDMEQAPQEKGNKKIKANTVSGGRNKIRKILDKTRFSILPPKLFSDGGLSQSQDDS
IVGTRHCRHSLAIMPIPGTLSSSSPDLLQPTTSMLDFSNPSDIPDQVIRVFKADQQSCYI
IISKDTTAKEVVCQAVQEFGLTGASDTYSLCEVSVTPEGVIKQRRLPDQFSKLADRIQLN
GRYYLKNNMETETLCSDEDAQELLKESQLSMLQLSTIEVATQLSMRDFDLFRNIEPTEYI
DDLFKLDSKTGNTHLKQFEDIVNQETFWVASEILSESNQLKRMKIIKHFIKIALHCRECK
NFNSMFAIISGLNLAPVARLRGTWEKLPSKYEKHLQDLQDLFDPSRNMAKYRNILSSQSM
QPPIIPLFPVVKKDMTFLHEGNDSKVDGLVNFEKLRMIAKEIRHIIRMTSANMDPAMMFR
QRKKRWRSLGSLSQGSTNSNMLDVQGGAHKKRARRSSLLNAKKLYEDAQMARKVKQYLSS
LDIDTDEEKFQMMSLQWEPAYGTLTKNLTEKRSAKSSEMSPVPLRSVGQTAKVHLHQPHR
VSQVLQVPAVNLHPIRKKGQAKDHVLSTSLPQKGLGPTEEVSVKKHTEDTISVASSLHSS
PPASPQNSPRKVGSILSDHSILLRLSGSSSSPPREPSTKISGQSCPGIGGVYLQKKILQI
TGSTAKRTDRTKKATEENRDRTRCEDTTRRRMTSPFRRFRERTLSRERLVNNQKEDAHHN
QATDSCEKVKDVGSNITDERGNAIYDSSSQGHSTALSCFCTRFKTKRRKTL
Download sequence
Identical sequences Q5NCJ5
ENSMUSP00000104522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]