SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000104523 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000104523
Domain Number 1 Region: 380-516
Classification Level Classification E-value
Superfamily Ras GEF 1.44e-24
Family Ras GEF 0.0024
Further Details:      
 
Domain Number 2 Region: 258-382
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.02e-19
Family cAMP-binding domain 0.001
Further Details:      
 
Domain Number 3 Region: 17-118
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000117
Family cAMP-binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000104523   Gene: ENSMUSG00000037533   Transcript: ENSMUST00000108895
Sequence length 544
Comment pep:known chromosome:GRCm38:11:54522890:54635009:1 gene:ENSMUSG00000037533 transcript:ENSMUST00000108895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSPVDPGARQALRKKPPERTPEDLNIIYSYLHGMEILSNLREHQLRLMSTRARYERYSG
NQMLFCSETIARCWYILLSGSVLVKDSMVLPPCSFGKQFGGKRGCDCLVLEPSEMIVVEN
SKDNEDSILQREIPARQSRRRFRKINYKGERQTIIDGVDINNYLSLPADLTKMHLTDNPH
PQVTHVSSSQSGCSIASDSGSSSLSDIYQATESEVGDVDLTRLPEGPVDSEDEEEEEEEI
DRTDPLQGRDLVRECLEKEPADKTDDDVEQLLEFMHQLPAFANMTMSVRRELCSVMVFEV
VEQAGAVILEDGQELDSWYVILNGTVEISHPDGKIENLFMGNSFGIVPTLDKQHMHGAVR
TKVDDCQFVCIAQQDYWRILNHVEKNTHKVEEEGEIVMVHEHRELDRSGTRKGHIVIKAT
PERLIMHLIEEHSIVDPTYIEDFLLTYRTFLETPLDVGIKLLEWFKIDNLRDKVTRIVLL
WVNNHFNDFEGDPAMTQFLEEFERNLEDTVRLKRICFYNSAFSLPLSKNSNSEHVLSSPV
SVVA
Download sequence
Identical sequences Q5NCJ2
ENSMUSP00000104523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]