SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000104562 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000104562
Domain Number 1 Region: 3-48
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.32e-17
Family KRAB domain (Kruppel-associated box) 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000104562   Gene: ENSMUSG00000074529   Transcript: ENSMUST00000108934
Sequence length 81
Comment pep:putative chromosome:GRCm38:2:177903340:177925604:-1 gene:ENSMUSG00000074529 transcript:ENSMUST00000108934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLVTYDDVHMNFTQEEGALLETSQKNLYKDVMLETYRNLSAIGNYTRNNVNLTNITCAN
ERPPKGDPHSSLGTAADPRRH
Download sequence
Identical sequences A2AW64
NP_898958.1.92730 ENSMUSP00000104562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]