SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105208 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105208
Domain Number 1 Region: 54-180
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.55e-23
Family cAMP-binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 189-255
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000497
Family cAMP-binding domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105208   Gene: ENSMUSG00000038085   Transcript: ENSMUST00000109580
Sequence length 544
Comment pep:putative chromosome:GRCm38:2:156312633:156375638:1 gene:ENSMUSG00000038085 transcript:ENSMUST00000109580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMNRVCKMFRQGLRGFREYQIIEPVHKKHPDFSFWDKKKQGRISFVTEDFAAQEKKPSWR
THQEIQDLCNILQALDCYRSYTESLQLLLAKVIRFERFGRRRVIVKKGQMGNSFYFIYLG
TVAITEDEDGSSAFLDPHPTLLHRGGSFGEMGLLSTTVRSATVVCMEETEFLVVDREDFV
ANKLGDEVQKETQYRYNFFRNLDIFQSWSEEKLWKLVALGRIERFSYGQMVSKDFMNSAF
ITFICQGNCEILRLVALGDCSAYYKWVWQQLELLDHKPLRIHDNEISPKERFKELQIKSY
PLQDFTYLKLLRLQKAREQQGIDFHGKINKVENTLPKLLGPKIKSRFGHLVKCSMVNTKF
GELPKEAIVGVYMKIHKTEEGEIVGLHQAFVPEIQRDCRPFILLSLGSELIQVRKEKFYD
MVDEETRAKIIKMDVDYPSDEDLCQSFLKENDYIVFRKDLLRLLVEPLNKSPFIPVQTKK
KEIYNHKSLFLDLCSLEKKVKQHYPIFLAPQKYLPPLRVVQAISAPRHKIQELLPQYKNA
GVLI
Download sequence
Identical sequences A2AV96
ENSMUSP00000105208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]