SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105313 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105313
Domain Number 1 Region: 297-459,560-813
Classification Level Classification E-value
Superfamily Ras GEF 2.22e-106
Family Ras GEF 0.00013
Further Details:      
 
Domain Number 2 Region: 467-569
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.73e-33
Family Ras-binding domain, RBD 0.0000112
Further Details:      
 
Domain Number 3 Region: 30-148
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.07e-27
Family DEP domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105313   Gene: ENSMUSG00000041992   Transcript: ENSMUST00000109691
Sequence length 814
Comment pep:known chromosome:GRCm38:12:117516479:117756978:1 gene:ENSMUSG00000041992 transcript:ENSMUST00000109691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTGDCQTLSRRISNPYLEHSPSQIYGENSSCAGRALRNIIILQAADLVKDRVNLKGFYR
RSCVGSELVDWLLEHCPFVQCRSMAIGVWQLLLDMGIMSSVDQHLYFQDNYVFYQFSSDE
CSYLYCEFEREEEWQKGVKLLLELVHLIPARAGICDLSHQKTEDSEESSDEILARLTSAV
QRELAAVIALKARKSAIEQDDENADKHVTVTEANNGPDPQAGVMCKLQERDDIGRIELVH
KLARENCQFLQTEKKESEKLEQQDDEVTMVQVKEQGQSVLVLKKVASCGPAPTSGSAEND
ARYVVVSGTPEKILEHLLNDLHLAEVQHKETETLLDDFLLTYTVFMTTDDLCQALLRHYS
AKKYQGEEENSDVPCRKRKVLHLVSQWISLYKDWLHEDEHSKMFLKTIYRNVLDDVYEYP
ILEKELKEFQKILGVYRRHTVDEYSPQKKNKALFHQFSLKENWLQHRGTVAETEEIFCHV
YITEHSYISVKAKVSSTAQEILKVVAEKLQRAEEDLALVAITFSGEKHEFQPNDLAISKS
LEASGRIYVYRKDLADTLNPLAENEESQQRSMRILGMNTWDLALELMSFDWSLFNSIHEQ
ELIYFTFSRQGNGENTVNLSLLLQRCNEVQLWVATEILLCSQLGKRVQLVKKFIKIAAHC
KAQQNLNSFFAIVMGLNTASVSRLSQTWEKIPGKFKKLFSELESLTDPSLNHKAYRDAFK
KMKPPKIPFMPLLLKDVTFIHEGNKTFLDNLVNFEKLHMIADTVRTLRHCRTNQFGSDVS
PKEQQELKSYVNHLYVIDSQQALFELSHRLEPRA
Download sequence
Identical sequences Q8C0Q9
ENSMUSP00000105313 ENSMUSP00000105313 ENSMUSP00000105313 NP_787126.3.92730 10090.ENSMUSP00000105313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]