SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105805 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105805
Domain Number 1 Region: 5-77
Classification Level Classification E-value
Superfamily Globin-like 0.0000000000235
Family Globins 0.0000427
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105805   Gene: ENSMUSG00000021032   Transcript: ENSMUST00000110176
Sequence length 92
Comment pep:putative chromosome:GRCm38:12:87098025:87102350:-1 gene:ENSMUSG00000021032 transcript:ENSMUST00000110176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPESELIRQSWRVVSRSPLEHGTVLFARLFALEPSLLPLFQYNGRQFSSPEDCLSSPE
FLDHIRKTLAACHPLILDISALKASLVEKPGC
Download sequence
Identical sequences D3YW07
ENSMUSP00000105805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]