SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105806 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105806
Domain Number 1 Region: 5-152
Classification Level Classification E-value
Superfamily Globin-like 1.07e-31
Family Globins 0.000000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105806   Gene: ENSMUSG00000021032   Transcript: ENSMUST00000110177
Sequence length 155
Comment pep:novel chromosome:GRCm38:12:87097531:87102522:-1 gene:ENSMUSG00000021032 transcript:ENSMUST00000110177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPESELIRQSWRVVSRSPLEHGTVLFARLFALEPSLLPLFQYNGRQFSSPEDCLSSPE
FLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHRAVGVRLSSFSVGSGTVGESLLYM
LEKCLGPDFTPATRTAWSRLYGAVVQAMSRGWDGE
Download sequence
Identical sequences Q3USR6
10090.ENSMUSP00000105806 ENSMUSP00000105806 NP_001281237.1.92730 ENSMUSP00000105806 ENSMUSP00000105805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]