SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105810 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105810
Domain Number 1 Region: 24-245,302-377
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.21e-39
Family FAD-linked reductases, N-terminal domain 0.0017
Further Details:      
 
Domain Number 2 Region: 202-314
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.75e-25
Family L-aminoacid/polyamine oxidase 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105810   Gene: ENSMUSG00000027333   Transcript: ENSMUST00000110181
Sequence length 385
Comment pep:novel chromosome:GRCm38:2:131491964:131525922:1 gene:ENSMUSG00000027333 transcript:ENSMUST00000110181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSCESSGDSADDPLSRGLRRRGQPRVVVIGAGLAGLAAARALLEQGFTDVTVLEASSHI
GGRVQSVRLGDTTFELGATWIHGSHGNPIYQLAEANGLLEETTDGERSVGRISLYSKNGV
ACYLTNRGCRIPKDVVEEFSDLYNEVYNMTQEFFRHGKPVNAESQNSVGVFTREKVRNRI
RDDPDDTEATKRLKLAMIQQYLKEPFWGPECNSLQFVWEDEAESCTLTYPPELWYRKICG
FDVLYPPERYGHVLSGWICGEEALVMERCDDEAVAEICTEMLRQFTGNPNIPKPRRILRS
AWGSNPYFRGSYSYTQVGSSGADVEKLAKPLPYTESSKTAPMQVLFSGEATHRKYYSTTH
GALLSGQREAARLIEMYRDLFQQGP
Download sequence
Identical sequences Q3TLR8
NP_001171308.1.92730 ENSMUSP00000105810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]