SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105928 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105928
Domain Number 1 Region: 142-458
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.87e-119
Family Transglutaminase core 0.0000000000847
Further Details:      
 
Domain Number 2 Region: 3-140
Classification Level Classification E-value
Superfamily E set domains 2.66e-40
Family Transglutaminase N-terminal domain 0.00000578
Further Details:      
 
Domain Number 3 Region: 482-594
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.25e-30
Family Transglutaminase, two C-terminal domains 0.00000195
Further Details:      
 
Domain Number 4 Region: 594-692
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.84e-26
Family Transglutaminase, two C-terminal domains 0.00000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105928   Gene: ENSMUSG00000027401   Transcript: ENSMUST00000110299
Sequence length 693
Comment pep:known chromosome:GRCm38:2:130012349:130050399:1 gene:ENSMUSG00000027401 transcript:ENSMUST00000110299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALQIQNVNWQVPMNRRAHHTDKFSSQDSIVRRGQPWEIILVCNRSLESGEDLNFIVST
GPQPSESARTKAVFSISGRSTGGWNAALKANSGNNLAIAIASPVSAPIGLYTLSVEISSR
GRASSLKLGTFIMLFNPWLQADDVFMSNHAERQEYVEEDSGIIYVGSTNRIGMVGWNFGQ
FEEDILNISLSILDRSLNFRRDPVTDVARRNDPKYVCRVLSAMINGNDDNGVISGNWSGN
YTGGVDPRTWNGSVEILKNWKKSGFRPVQFGQCWVFAGTLNTVLRCLGVPSRVITNFNSA
HDTDRNLSVDVYYDAMGNPLEKGSDSVWNFHVWNEGWFVRTDLGPTYNGWQVLDATPQER
SQGVFQCGPASVNAIKAGDVDRNFDMIFIFAEVNADRITWIYNNRNNTQKQNSVDTHSIG
KYISTKAVGSNSRMDVTDKYKYPEGSSEERQVHQKALDKLKPNASFGATSSRNPEGEDKE
PSISGKFKVTGILAVGKEVSLSLMLKNMTNDRKTVTMNMTAWTIVYNGTLVHEVWKDSAT
ISLDPEEEIQYPVKIAYSQYERYLKADNMIRITAVCKVPDEAEVVVERDVILDNPALTLE
VLEQAHVRKPVNVQMLFSNPLDQPVNNCVLLVEGSGLLRGSLKIDVPSLRPKEKSRIRFE
IFPTRSGTKQLLADFSCNKFPAIKAMLPIDVSE
Download sequence
Identical sequences Q08189
10090.ENSMUSP00000105928 ENSMUSP00000105928 NP_033400.2.92730 ENSMUSP00000105928 ENSMUSP00000105928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]