SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000106225 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000106225
Domain Number 1 Region: 70-184
Classification Level Classification E-value
Superfamily Ras GEF 4.05e-18
Family Ras GEF 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000106225   Gene: ENSMUSG00000095557   Transcript: ENSMUST00000110595
Sequence length 307
Comment pep:known chromosome:GRCm38:5:146556164:146558737:1 gene:ENSMUSG00000095557 transcript:ENSMUST00000110595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSCFQGSRGSGHKKAKSGFLVRFWRRLIRPLTHFRHASHSEPKVCSQNEQEPDSLPKRP
QFNYDSQEYVVQMIHYIPAAIQKRDHICITIFLGVYRTYASTWEVLDLLMRTYASFRPDC
IKDQQTKRAIFRFLFGWFKKYPQDFYESPDLAVVRQFIDYVKHNVPSSDVDRARELLSVL
EDQEAIELQIEQAPEPSEQDASGRQETLAPRPASETEPQGDKQPREDPELVKGAVLDPSE
PKATIELPPSLHQAVPTSDGTLSPVDVTADEATDVAADVSPARQLFVSYTVQLGTPDFVI
PLPEVDI
Download sequence
Identical sequences L7N249
ENSMUSP00000106225 ENSMUSP00000106225 10090.ENSMUSP00000106225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]