SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000106226 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000106226
Domain Number 1 Region: 70-185
Classification Level Classification E-value
Superfamily Ras GEF 4.58e-18
Family Ras GEF 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000106226   Gene: ENSMUSG00000079091   Transcript: ENSMUST00000110596
Sequence length 307
Comment pep:known chromosome:GRCm38:5:146525801:146528553:1 gene:ENSMUSG00000079091 transcript:ENSMUST00000110596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSCFQGSRGSGHKKAKSGFLVRFWRRLIRPLTHFRHASHSEPKVCSQNEQEPDSLPKRP
QFNYDSQEYVVQMIHYIPAAIQKRDHICITIFLGVYRTYASTWEVLDLLMRTYASFRPDC
IKDQQTKRAIFRFLFGWFKKYPQDFYESPDLAVVRQFIDYVKRNVPSSDVDRARELLSVL
EDQEAIELQIEQAPEPSEQDASGRQETLAPRPASETEPQGDKQPREDPELVKGAVLDPFE
PKATIELPPSLHQAVPTSDGTLSPVDVTADEATGVAADVSPARQLFVSYTVQLGTPDFVI
PLPEVDI
Download sequence
Identical sequences Q9D506
ENSMUSP00000106226 10090.ENSMUSP00000106226 NP_001230038.1.92730 ENSMUSP00000106226 ENSMUSP00000106226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]