SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000106228 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000106228
Domain Number 1 Region: 70-186
Classification Level Classification E-value
Superfamily Ras GEF 6.28e-18
Family Ras GEF 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000106228   Gene: ENSMUSG00000079093   Transcript: ENSMUST00000110598
Sequence length 319
Comment pep:known chromosome:GRCm38:5:146502428:146505183:1 gene:ENSMUSG00000079093 transcript:ENSMUST00000110598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSCFQGSRGSGHKKAKSGFLVRFWRRLIRPLTHFRHASHSEPKVCSQNEQEPDSLPKRP
QFNYDSQEYVVQMIHYIPAAIQKRDHICITIFLGVYRTYASTWEVLDLLMRTYASFRPDC
IKDQQTKRAIFRFLFGWFKKYPQDFYESPDLAVVRQFIDYVKRNVPSSDVDRARELLSVL
EDQEAIELQIEQDFATAPEPSEQDASGRQESLAPRPASETEPQGDKQHREDAELVKGAVL
DPFKPKATIELHPTLHQAVPASDGSLSPVDVTADEATGVAADEAADVAADVSLARQLFVS
YTVQLGTPDFVIPLPEVDI
Download sequence
Identical sequences Q9D5E3
ENSMUSP00000106228 ENSMUSP00000106228 NP_080412.1.92730 ENSMUSP00000106228 10090.ENSMUSP00000106228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]