SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000106229 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000106229
Domain Number 1 Region: 70-184
Classification Level Classification E-value
Superfamily Ras GEF 4.18e-18
Family Ras GEF 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000106229   Gene: ENSMUSG00000096664   Transcript: ENSMUST00000110599
Sequence length 315
Comment pep:known chromosome:GRCm38:5:146537648:146540427:1 gene:ENSMUSG00000096664 transcript:ENSMUST00000110599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSCFQGSRGSGHKKAKSGFLVRFWRRLIRPLIHFRHASHSEPKVCSQNEQEPDSLPKRP
QFNYDSQEYVVQMIHYIPAAIQKRDHICITIFLGVYRTYASTWEVLDLLMRTYASFRPDC
IKDQQTKRAIFRFLFGWFKKYPQDFYESPDLAVVRQFIDYVKHNVPSSDVDRARELLSLL
EDQEAIELQIEQAPEPSEQDASGRQETLALRPASETEPQGDKQPREDPELVKGAVLDPSE
PKATIELPPSLHQAVPTSDGTLSPVDVTADEATGVAADEAADVAADVSPARQLFVSYTVQ
LGTPDFVIPLPEVDI
Download sequence
Identical sequences L7N464
ENSMUSP00000106229 ENSMUSP00000106229 NP_001230042.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]