SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000106241 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000106241
Domain Number 1 Region: 70-184
Classification Level Classification E-value
Superfamily Ras GEF 5.36e-18
Family Ras GEF 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000106241   Gene: ENSMUSG00000096527   Transcript: ENSMUST00000110611
Sequence length 311
Comment pep:known chromosome:GRCm38:5:146491363:146494132:1 gene:ENSMUSG00000096527 transcript:ENSMUST00000110611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSCFQGSRGSGHKKAKSGFLVRFWRRLIRPLTHFRHASHSEPKVCSQNEQEPDSLPKRP
QFNYDSQEYVVQMIHYIPAAIQKRDHICITIFLGVYRTYASTWEVLDLLMRTYASFRPDC
IKDQQTKRAIFRFLFGWFKKYPQDFYESPDLAVVRQFIDYVKRNVPSSDVDRARELLSVL
EDQEAIELQIEQAPEPSEQDASGRQETLAPRPASETEPQGDKQHREDAELVKGAVLDPFK
PKATIELHPTLHQAVPTSDGSLSPVDVTADEATGVAADVAADVSPARQLFVSYTVQLGTP
DFIFPLPEVDI
Download sequence
Identical sequences L7N250
ENSMUSP00000106241 ENSMUSP00000106241 NP_001230039.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]