SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000106317 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000106317
Domain Number 1 Region: 570-634
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000025
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 2 Region: 499-545
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000667
Family TSP-1 type 1 repeat 0.00068
Further Details:      
 
Domain Number 3 Region: 626-682
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000181
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 4 Region: 26-73
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000432
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 5 Region: 78-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000357
Family LDL receptor-like module 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000106317
Domain Number - Region: 451-489
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00149
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000106317   Gene: ENSMUSG00000079105   Transcript: ENSMUST00000110689
Sequence length 845
Comment pep:known chromosome:GRCm38:15:4988762:5063773:-1 gene:ENSMUSG00000079105 transcript:ENSMUST00000110689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVTSLLILVCFIAAFQVFSRASSPVNCKWDSYGPWSECNGCTKTQTRRRSVAVYGQYGG
YPCEGSAFETQSCKPERGCPTEEGCGDRFRCFSGQCISKSLVCNGDPDCEEDGADEDKCE
NVANPSCNIDKPPPNIELTGYGYNVVTGQGKKRVINTKSFGGQCRKVFSGDGKDFYRLSG
NILSYTFQVKVDNDFNYEFYNSSWSYIKHTSTEQNTFYSWKGLFSHSRNTYGHGSAKEEI
DTKMKSYKLLVVQNTVEVAQFTNNNPEFLQVAEPFWKELSHLPTLYDYSAYRRLIDQYGT
HYLQSGSLGGEYRVLFYVDSGSAKETGFQSDQDNACSSADFQFLFTSSADQRCMKQLETE
KSTSGNKGRLLRGKPLVRGGDSGFVADLSFLDLDNPAGNKQRYSSWAGSVTRLPQVIKEK
LAPLYELVKEVPCASVKRLYLKRAIEEYFDEFDPCHCRPCQNGGLAIVVETQCQCLCKPY
TFGSACEQGVLVGDQAGGVDGGWNCWSSWSPCVQGKRTRSRECNNPPPRDDGKSCLGETT
ESKQCEDQDLEKLRLLEPHCFHSSLAPKEFCLSPPALKDGFVQGEGTMVPVGQSVVYACD
EGYSLIGDPVARCGEDLQWLVGEMHCQKLACVLPGEMNGMQSHPQKPFYMVGEKVTLSCV
GGMSLEGPSTLLCGSSLKWSPELKDAKCVQKATSTPPPAAPACQPWEKLQNSKCICKMPY
ECGSSLDVCARDESRNKILSLTICKMHVVHCHKRNYTLVGKESCTLPSPAEKVCGACPIW
SKCDAQNGKCICREASECQTAGYRICVEVNGKEETMSECEAGILRCRGQSISITAIKPCA
EEAAQ
Download sequence
Identical sequences D3YXF5
NP_001230766.1.92730 ENSMUSP00000106317 ENSMUSP00000106317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]