SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000106441 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000106441
Domain Number 1 Region: 234-297
Classification Level Classification E-value
Superfamily BPTI-like 1.05e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0058
Further Details:      
 
Domain Number 2 Region: 361-421
Classification Level Classification E-value
Superfamily BPTI-like 1.14e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0041
Further Details:      
 
Domain Number 3 Region: 312-350
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000106441   Gene: ENSMUSG00000027315   Transcript: ENSMUST00000110817
Sequence length 507
Comment pep:known chromosome:GRCm38:2:119237553:119249527:1 gene:ENSMUSG00000027315 transcript:ENSMUST00000110817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRRLARASISAVGVWLLCALGLQATEAELPSAPAELPGGAACLSRFTSGVPSFVLDTE
ASVSNGATFLGSPTARRGWDCVRSCCTTQNCNLALVELQPDGGEDAISACFLMNCLYEQN
FVCKFAPKEGFINYLTQELYRSYRELRTRGFGGSRIPRIWMGIDLKVQLQKPLVLNEADN
TDWHLLQGDSDVRVERKRPEEVELWGLKEGTYLFQLTRTDSDQPEETANLTITVLTAKQT
EDYCLASYKVGRCRGSFPRWYYDPKEQICKSFTFGGCLGNKNNYLREEECMLACKDVQGI
SPKRHHPVCSGSCHATQFRCSNGCCIDGFLECDDTPDCPDGSDEATCEKYTSGFDELQNI
HFLSDKGYCAELPDTGFCKENIPRWYYNPFSERCARFTYGGCYGNKNNFEEEQQCLESCR
GISKKDVFGLRREGSIPTVGSAEVAIAVFLVICIIVVLTILGYCFFKNQRKEFHSPLHHP
PPTPASSTVSTTEDTEHLVYNHTTQPL
Download sequence
Identical sequences Q9R097
NP_058603.2.92730 XP_006499125.1.92730 10090.ENSMUSP00000028783 ENSMUSP00000028783 ENSMUSP00000028783 ENSMUSP00000028783 ENSMUSP00000106440 ENSMUSP00000106441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]