SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000106515 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000106515
Domain Number 1 Region: 119-240
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.59e-33
Family cAMP-binding domain 0.00000113
Further Details:      
 
Domain Number 2 Region: 248-372
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.96e-32
Family cAMP-binding domain 0.000000843
Further Details:      
 
Domain Number 3 Region: 15-62
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.39e-18
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000106515   Gene: ENSMUSG00000025855   Transcript: ENSMUST00000110890
Sequence length 381
Comment pep:known chromosome:GRCm38:5:139017308:139130386:-1 gene:ENSMUSG00000025855 transcript:ENSMUST00000110890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPSCFHSEDEDSLKGCEMYVQKHGIQQVLKECIVHLCVAKPDRPLRFLREHFEKLEKE
ENRQILARQKSNSQCDSHDEEISPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPK
DYKTMTALAKAISKNVLFSHLDDNERSDIFDAMFPVTHIGGETVIQQGNEGDNFYVIDQG
EVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTL
RKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTA
SVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLG
PCSEILKRNIQRYNSFISLTV
Download sequence
Identical sequences P12849
10090.ENSMUSP00000106515 ENSMUSP00000026973 ENSMUSP00000106515 ENSMUSP00000026973 ENSMUSP00000026973 NP_001240819.1.92730 NP_032949.3.92730 XP_006504723.1.92730 XP_006504724.1.92730 XP_006504726.1.92730 XP_017176208.1.92730 XP_021042490.1.100879 XP_021042491.1.100879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]