SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000106699 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000106699
Domain Number 1 Region: 927-1202
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.6e-55
Family Patatin 0.049
Further Details:      
 
Domain Number 2 Region: 141-279
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.71e-24
Family cAMP-binding domain 0.013
Further Details:      
 
Domain Number 3 Region: 592-710
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.43e-22
Family cAMP-binding domain 0.009
Further Details:      
 
Domain Number 4 Region: 475-594
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.83e-19
Family cAMP-binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000106699   Gene: ENSMUSG00000004565   Transcript: ENSMUST00000111070
Sequence length 1327
Comment pep:known chromosome:GRCm38:8:3515384:3544266:1 gene:ENSMUSG00000004565 transcript:ENSMUST00000111070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAPLQTGMVLGVMIGAGVAVLVTAVLILLVVRRLRVQKTPAPEGPRYRFRKRDKVLFYG
RKIMRKVSQSTSSLVDTSVSTTSRPRMKKKLKMLNIAKKILRIQKETPTLQRKEPPPSVL
EADLTEGDLANSHLPSEVLYMLKNVRVLGHFEKPLFLELCRHMVFQRLGQGDYVFRPGQP
DASIYVVQDGLLELCLPGPDGKECVVKEVVPGDSVNSLLSILDVITGHQHPQRTVSARAA
RDSTVLRLPVEAFSAVFTKYPESLVRVVQIIMVRLQRVTFLALHNYLGLTNELFSHEIQP
LRLFPSPGLPTRTSPVRGSKRVVSTSGTEDTSKETSGRPLDSIGAPLPGPAGDPVKPTSL
EAPPAPLLSRCISMPVDISGLQGGPRSDFDMAYERGRISVSLQEEASGGPQTASPRTPTQ
ELREQPAGACEYSYCEDESATGGCPFGPYQGRQTSSIFEAAKRELAKLMRIEDPSLLNSR
VLLHHAKAGTIIARQGDQDVSLHFVLWGCLHVYQRMIDKAEEVCLFVAQPGELVGQLAVL
TGEPLIFTLRAQRDCTFLRISKSHFYEIMRAQPSVVLSAAHTVAARMSPFVRQMDFAIDW
TAVEAGRALYRQGDRSDCTYIVLNGRLRSVIQRGSGKKELVGEYGRGDLIGVVEALTRQP
RATTVHAVRDTELAKLPEGTLGHIKRRYPQVVTRLIHLLSQKILGNLQQLQGPFPGSGLS
VPQHSELTNPASNLSTVAILPVCAEVPMMAFTLELQHALQAIGPTLLLNSDVIRALLGAS
ALDSIQEFRLSGWLAQQEDAHRIVLYQTDTSLTPWTVRCLRQADCILIVGLGDQEPTVGQ
LEQMLENTAVRALKQLVLLHREEGPGPTRTVEWLNMRSWCSGHLHLRCPRRLFSRRSPAK
LHELYEKVFSRRADRHSDFSRLARVLTGNTIALVLGGGGARGCSHIGVLKALEEAGVPVD
LVGGTSIGSFIGALYAEERSASRTKQRAREWAKSMTSVLEPVLDLTYPVTSMFTGSAFNR
SIHRVFQDKQIEDLWLPYFNVTTDITASAMRVHKDGSLWRYVRASMTLSGYLPPLCDPKD
GHLLMDGGYINNLPADIARSMGAKTVIAIDVGSQDETDLSTYGDSLSGWWLLWKRLNPWA
DKVKVPDMAEIQSRLAYVSCVRQLEVVKSSSYCEYLRPSIDCFKTMDFGKFDQIYDVGYQ
YGKAVFGGWTRGEVIEKMLTDRRSTDLNESRRADILAFPSSGFTDLAEIVSRIEPPTSYV
SDGCADGEESDCLTEYEEDAGPDCSRDEGGSPEGASPSTASEVEEEKSTLRQRRFLPQET
PSSVADA
Download sequence
Identical sequences ENSMUSP00000004681 ENSMUSP00000004681 10090.ENSMUSP00000004681 NP_056616.2.92730 XP_006508888.2.92730 ENSMUSP00000004681 ENSMUSP00000106699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]