SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000106765 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000106765
Domain Number 1 Region: 275-403
Classification Level Classification E-value
Superfamily ApaG-like 1.03e-40
Family ApaG-like 0.00021
Further Details:      
 
Domain Number 2 Region: 94-260
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.45e-21
Family SMI1/KNR4-like 0.0079
Further Details:      
 
Domain Number 3 Region: 6-77
Classification Level Classification E-value
Superfamily F-box domain 0.000000000157
Family F-box domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000106765   Gene: ENSMUSG00000027180   Transcript: ENSMUST00000111135
Sequence length 410
Comment pep:known chromosome:GRCm38:2:104027844:104057523:1 gene:ENSMUSG00000027180 transcript:ENSMUST00000111135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVEAETGLLTLESLPTDPLLLILSFVDYRDLINRRLSQLSTHDPLWRRHCKKYWLISE
EEKAGKSQCWRSLFIETYSDVGRYIDHYAAIKKAWRDLKKYLEPRCPRMVLSLKEGAREE
DLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTAAGGFQ
QRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFIIGATF
TDWFTSYVNNVVSGGFPIIRDQIFRYIHDPECVATTGDITVSVSTSFLPELSSVHPPHYF
FTYRIRIEMSRDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPGRIYEYTS
CTTFSTTSGYMEGYYTFHFLYFKDKVFNVAIPRFHMACPTFRVSIARLVS
Download sequence
Identical sequences ENSMUSP00000106765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]