SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000106766 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000106766
Domain Number 1 Region: 280-359
Classification Level Classification E-value
Superfamily ApaG-like 1.44e-23
Family ApaG-like 0.00067
Further Details:      
 
Domain Number 2 Region: 99-265
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.35e-21
Family SMI1/KNR4-like 0.0079
Further Details:      
 
Domain Number 3 Region: 6-82
Classification Level Classification E-value
Superfamily F-box domain 1.96e-16
Family F-box domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000106766   Gene: ENSMUSG00000027180   Transcript: ENSMUST00000111136
Sequence length 361
Comment pep:known chromosome:GRCm38:2:104027846:104063003:1 gene:ENSMUSG00000027180 transcript:ENSMUST00000111136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVEAETGLLTLESLPTDPLLLILSFVDYRDLINCCYVSRRLSQLSTHDPLWRRHCKKY
WLISEEEKAGKSQCWRSLFIETYSDVGRYIDHYAAIKKAWRDLKKYLEPRCPRMVLSLKE
GAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTA
AGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFI
IGATFTDWFTSYVNNVVSGGFPIIRDQIFRYIHDPECVATTGDITVSVSTSFLPELSSVH
PPHYFFTYRIRIEMSRDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPGNG
S
Download sequence
Identical sequences A2BHN6
ENSMUSP00000106766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]