SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000107011 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000107011
Domain Number 1 Region: 66-334
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-84
Family Nuclear receptor ligand-binding domain 0.00000000356
Further Details:      
 
Domain Number 2 Region: 13-95
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.26e-31
Family Nuclear receptor 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000107011   Gene: ENSMUSG00000015843   Transcript: ENSMUST00000111380
Sequence length 340
Comment pep:novel chromosome:GRCm38:1:167618309:167639621:1 gene:ENSMUSG00000015843 transcript:ENSMUST00000111380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKDCLI
DKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSSHEDMPVERILEAE
LAVEPKTESYGDMNVENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVILLR
AGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKDMQM
DKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLLLRL
PALRSIGLKCLEHLFFFKLIGDTPIDSFLMEMLETPLQIT
Download sequence
Identical sequences E9Q9V9 Q6LDB2
ENSMUSP00000107011 NP_001153203.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]