SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000107143 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000107143
Domain Number 1 Region: 1-160
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.29e-39
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000107143   Gene: ENSMUSG00000040181   Transcript: ENSMUST00000111518
Sequence length 182
Comment pep:novel chromosome:GRCm38:1:162840218:162859954:-1 gene:ENSMUSG00000040181 transcript:ENSMUST00000111518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSSDLGGLWRFTEHVEEGRASLYKSVVS
NSSREMSCYPDFPFPEDYPNFVPNSLFLEYLKLYSTQFNLQRCIYFNTKVCSITKRPDFA
VSGQWEVVTVTNGKQNSAIFDAVMVCTGFLTNPHLPLDSFPVCFTGTFITVVPQLMSSEF
GS
Download sequence
Identical sequences Q8C9C1
ENSMUSP00000107143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]