SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000107182 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000107182
Domain Number 1 Region: 733-809,840-928
Classification Level Classification E-value
Superfamily RUN domain-like 6.41e-38
Family RUN domain 0.0014
Further Details:      
 
Domain Number 2 Region: 1091-1268
Classification Level Classification E-value
Superfamily RUN domain-like 6.41e-29
Family RUN domain 0.016
Further Details:      
 
Domain Number 3 Region: 950-1034
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 3.29e-16
Family Lipoxigenase N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000107182   Gene: ENSMUSG00000030313   Transcript: ENSMUST00000111557
Sequence length 1274
Comment pep:known chromosome:GRCm38:6:148988071:149101680:-1 gene:ENSMUSG00000030313 transcript:ENSMUST00000111557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSSAAPGPGSGSSPAACRFAHYFVLCGIDADSGLEPDELAGENFDQSPLRRTFKSKVL
AHYPQNIEWNPFDQDAVNMLCMPKGLSFRTQADNKEPQFHSFIITREDGSRTYGFVLTFY
EEVTSKQICTAMQTLYQMHNAEQYSSVYASSSCSMDSLASSIDEGDATSLLKLQRYNSYD
INRDTLYVSKSICLITPLPFMQACKKFLFQLHKAVTSQQPPPLPLESYIHNILYEVPLPP
PGRSLKFYGVYEPVICQRPGPNELPLSDYPLREACELLGLENLVQVFTCVLLEMQTLLYS
QDYQRLMTVAEGITTLLFPFQWQHVYVPILPASLLHFLDAPVPYLMGLQSKEGTDRSKLE
LPQEANLCFVDIDNHFIELPEEFPQFPNKVDFIQELSEVLLQFGIPPEGSLHSSESATKL
KNMVLKDLANDKKNGNVPNNSVSVYELLKGSETIARLQALAKRTGVTMEKIDLPASLSEK
EKDLKLQCEEADLRDSQLNVQLREVFANRFTQMFADYEAFVIQTAQDMESWLTNREQMQN
FDKASFLSDQPEPYLPFLSRFIETQMFATFIDNKIMSQWEEKDPLLRVFDSRIEKIRLYN
VRAPTLRTSIYQKCSSLKEAAQSIEQRLMKMDHTAIHPHLLDMKIGQGKYEQGFFPKLQS
DVLATGPANNNRWVSRSATAQRRKERLRQSSEHIGLDSDLREKYMQEARSLGKNLRQPKL
SDLSPAVIAQTNWKFVEGLLKECRMKTKRMLVEKMGHEAVELGHGEANITGLEENTLIAS
LCDLLERIWSHGLLVKQGKSALWSHLLQFQDREEKQEHLTDSPVALGPERRKSDSGVMLP
TLRVSLIQDMRHIQNMTEIKTDVGRARAWIRLSLEKKLLSQHLKQLLSNQPLTKKLYKRY
AFLRCEEEREQFLYHLLSLNAVDYFCFTSVFTTIMIPYRSVIIPIKKLSNAIITSNPWIC
VSGELGDTGVMQIPKNLLEMTFECQNLGKLTTVQIGHDNSGLLAKWLVDCVMVRNEITGH
TYRFPCGRWLGKGVDDGSLERILIGELMTSASDEDLGKQCRTPPQQKSPTTTRRLSITSL
TGKPAKPNAGQIQEGIGEAVNNIVKHFHKPEKERGSLTVLLCGENGLVAALEQVFHHGFK
SARIFHKNVFIWDFVEKAVAYFETTDQILDNEGDVLIQKPSSKTFCHYVNAINTAPRNIG
KDGKFQILVCLGTRDHLLPQWIPLLAECPAITRMYEENALLRDHMTVNSLIRILQTIQDF
TIVLEGSLIKGVDV
Download sequence
Identical sequences A2RSQ0
ENSMUSP00000107182 ENSMUSP00000107182 ENSMUSP00000107182 10090.ENSMUSP00000107182 NP_796166.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]