SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000107490 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000107490
Domain Number 1 Region: 86-413,443-555
Classification Level Classification E-value
Superfamily Ras GEF 6.93e-120
Family Ras GEF 0.0000611
Further Details:      
 
Domain Number 2 Region: 674-769
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.36e-41
Family Ras-binding domain, RBD 0.00000621
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000107490   Gene: ENSMUSG00000026482   Transcript: ENSMUST00000111859
Sequence length 803
Comment pep:putative chromosome:GRCm38:1:152516760:152766305:-1 gene:ENSMUSG00000026482 transcript:ENSMUST00000111859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGTSVGEPTQVVSKVKLSTKGENTGHWLVDDHARIWEVLKTEESSIQDWGEEVEEGAVY
HVTLKRVQIQQAANKGARWLGVEGDQLPPGHTVSQYETCKIRTIKAGTLEKLVENLLTAF
GDNDFTYISIFLSTYRGFASTKEVLELLLDRYGNLTGPNCEDDGSQSSPESKAVIRNAIA
SILRAWLDQCAEDFREPPHFPCLQKLLEYLKQMMPGSDPERRAQNLLEQFQKQDVDSDNG
LLNTSSFSLEEEEELESGGSAEFTNFSEDLVAEQLTYMDAQLFKKVVPHHCLGCIWSQRD
KKENKHLAPTIRATISQFNTLTKCVVSTVLGSKELKTQQRARVIEKWINIAHECRILKNF
SSLRAIVSALQSNSIYRLKKAWAAVPKDRMLMFEELSDIFSDHNNHLTSRELLMKEGTSK
FANLDSSVKENQKRTQRRLQLQKDMGVMQGTVPYLGTFLTDLTMLDTALQDYIEGGLINF
EKRRREFEVIAQIKLLQSACNSYCMGPDQKFIQWFQRQQLLSEEESYALSCEIEAAADAN
TTSPKPRKSMVKRLSLLFLGSDIIPGSTPTKEQPKSAASGSSGESMDSVSVSSCESNHSE
AEEGPVTPMDTPDEPQKKLSESSSSCSSIHSMDTNSSGMSSLINPLSSPPTCNNNPKIHK
RSVSVTSITSTVLPPVYNQQNEDTCIIRISVEDNNGNMYKSIMLTSQDKTPAVIQRAMSK
HNLESDPAEEYELVQVISEDKELVIPDSANVFYAMNSQVNFDFILRKKNSVEEQVKLRSR
TSLTLPRTAKRGCWSNRHSKITL
Download sequence
Identical sequences E9Q8M9
ENSMUSP00000107488 ENSMUSP00000107490 10090.ENSMUSP00000107490 ENSMUSP00000107490 XP_006529327.1.92730 XP_006529328.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]