SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000107948 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000107948
Domain Number 1 Region: 484-812
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.93e-102
Family PDEase 0.000000606
Further Details:      
 
Domain Number 2 Region: 55-251
Classification Level Classification E-value
Superfamily GAF domain-like 5.67e-32
Family GAF domain 0.00046
Further Details:      
 
Domain Number 3 Region: 238-283,310-460
Classification Level Classification E-value
Superfamily GAF domain-like 6.67e-30
Family GAF domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000107948   Gene: ENSMUSG00000024992   Transcript: ENSMUST00000112329
Sequence length 836
Comment pep:known chromosome:GRCm38:19:38132781:38183947:1 gene:ENSMUSG00000024992 transcript:ENSMUST00000112329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEISQEAVERYLEKNPCFAKEYFDKKLRVEALGVIFKNSHAGVQTGLSLPEMTQVEESA
VCLELLQCMQDEAGSAEQMAHRALQRLAQLLQADCCSMFSCRARNGIPEVASRLLNVTPT
SKFEDNLVAPDREVVFPLDIGIVGWVAHVKKALNVSDVKKNSHFSDFMDKQTGYVTRNLL
AVPIVAGKEVLAVVMAVNKISAPEFSKQDEEVFSKYLSFVAVALRLQHTSYLYSVESRRS
QILMWSANKVFEELTDVERQFHKALYTIRTYLNCDRYSIGLLDMTKEKEFYDEWPIKLGE
VEPYKGPKTPDGREIIFYKIIDYILHGKEEINVIPSPPADHWTLVSGLPTYVAENGFICN
MLNAPADEYFTFQKGPVDETGWVIKNVLSLPIVNKKEDIVGVATFYNRKDGKPFDEHDEH
ITETLTQFLGWSLLNTDTYERVNKLESRKDIAQEMVMNLTKATPDEISSILKFKEKLNVE
VIEECEERQLLAILKEDLPDPRTADLYEFCFSDFPITEHELVKCGLRLFLEINVVEKFKV
PVEVLTRWMYTVRKGYRPVTYHNWRHGFNVGQTMFTLLMTGRLKKYYTDLEAFAMLAAAF
CHDIDHRGTNNLYQMKSTSPLARLHGTSILERHHLEYSKTLLQDESLNIFQNLNKRQFET
VIHLFEVAIIATDLALYFKKRTMFQKIVDTCEQMQSEEETIKYVTSDPTKKEVIMAMMMT
ACDLSAITKPWEVQSQPMMDRSKKDELPKLQVGFIDFVCTFVYKEFSRFHGEITPMLNGL
QNNRVEWKSLAEEYEAKVKVTEEEAGKQEEEASDGKAATDLGGSAEDKKSKTCLML
Download sequence
Identical sequences ENSMUSP00000107948 NP_001164430.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]