SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000108504 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000108504
Domain Number 1 Region: 79-93,212-459
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.55e-61
Family Nuclear receptor ligand-binding domain 0.000000153
Further Details:      
 
Domain Number 2 Region: 11-94
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.45e-29
Family Nuclear receptor 0.00015
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000108504
Domain Number - Region: 129-136
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0178
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000108504   Gene: ENSMUSG00000026751   Transcript: ENSMUST00000112883
Sequence length 462
Comment pep:known chromosome:GRCm38:2:38692656:38712234:-1 gene:ENSMUSG00000026751 transcript:ENSMUST00000112883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKT
QRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQIRANGFKL
ETGPPMGVPPPPPPPPDYMLPPSLHAPEPKALVSGPPSGPLGDFGAPSLPMAVPGPHGPL
AGYLYPAFSNRTIKSEYPEPYASPPQQPGPPYSYPEPFSGGPNVPELILQLLQLEPEEDQ
VRARIVGCLQEPAKSRSDQPAPFSLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQ
NCWSELLVLDHIYRQVQYGKEDSILLVTGQEVELSTVAVQAGSLLHSLVLRAQELVLQLH
ALQLDRQEFVCLKFLILFSLDVKFLNNHSLVKDAQEKANAALLDYTLCHYPHCGDKFQQL
LLCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT
Download sequence
Identical sequences P33242
ENSMUSP00000028084 ENSMUSP00000028084 ENSMUSP00000028084 ENSMUSP00000108504 10090.ENSMUSP00000028084 NP_001303616.1.92730 NP_620639.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]