SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000108522 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000108522
Domain Number 1 Region: 52-122
Classification Level Classification E-value
Superfamily Ribosomal protein S18 1.7e-22
Family Ribosomal protein S18 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000108522   Gene: ENSMUSG00000016833   Transcript: ENSMUST00000112901
Sequence length 128
Comment pep:putative chromosome:GRCm38:5:100798747:100804471:1 gene:ENSMUSG00000016833 transcript:ENSMUST00000112901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALVALCSGIGRKNLTTAAGCFTDRGTQAVSVIWRRCFSQFEQVTSNEDLPVPMENPYK
EPLKKCVLCEKRVDYKNVQLLSQFISPFTGCIYGRHITGLCGKKQREITKAIKRAQKMGK
HSCTAELN
Download sequence
Identical sequences Q8BTZ9
ENSMUSP00000108522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]