SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000108789 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000108789
Domain Number 1 Region: 14-221
Classification Level Classification E-value
Superfamily Ras GEF 1.44e-64
Family Ras GEF 0.0000719
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000108789   Gene: ENSMUSG00000038831   Transcript: ENSMUST00000113164
Sequence length 243
Comment pep:known chromosome:GRCm38:2:33259364:33371470:-1 gene:ENSMUSG00000038831 transcript:ENSMUST00000113164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYKRNGLMASVLVTSATPQGSSSSDSLEGQSCDYASKSYDAVVFDVLKVTPEEFASQITL
MDIPVFKAIQPEELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVREILTAQTLKIRAE
ILSHFVKIAKKLLELNNLHSLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMSK
EDNYKRTRDYIRSLKMVPSIPYLGMSLSYFIINFPGNITCSGPNKMFLQFLVEMFPGSSR
DHG
Download sequence
Identical sequences ENSMUSP00000108789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]