SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000108790 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000108790
Domain Number 1 Region: 14-304
Classification Level Classification E-value
Superfamily Ras GEF 2.35e-79
Family Ras GEF 0.0000363
Further Details:      
 
Domain Number 2 Region: 453-576
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-17
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000108790   Gene: ENSMUSG00000038831   Transcript: ENSMUST00000113165
Sequence length 584
Comment pep:known chromosome:GRCm38:2:33133421:33371486:-1 gene:ENSMUSG00000038831 transcript:ENSMUST00000113165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYKRNGLMASVLVTSATPQGSSSSDSLEGQSCDYASKSYDAVVFDVLKVTPEEFASQITL
MDIPVFKAIQPEELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVREILTAQTLKIRAE
ILSHFVKIAKKLLELNNLHSLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMSK
EDNYKRTRDYIRSLKMVPSIPYLGIYLLDLIYIDSAYPASGSIMENEQRSNQMNNILRII
ADLQVSCSYDHLTTLPHVQKYLKSVRYIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKE
DLAGPSAGSSSARFRRRPTCPDTSVAGSLPTPPVPRHRKSHSLGNNLMCQLSVVESKSAT
FPSEKARHLLDDSVLESRSPRRGLTHTSSTAITNGLSLGSSESSEFSEEMSAGLERGRLY
ATLGPNWRVPVRNSPRTRSCVYSPTSPCTCTVGSSATVPTMEGPLRRKTLLKEGRKPALS
SWTRYWVVLSGATLLYYGAKSLRGTDRKHYKSTPGKKVSIVGWMVQLPDDPEHPDIFQLN
NPDKGNVYKFQTGSRFHAILWHKHLDDACKSSRPQVPANLMSFE
Download sequence
Identical sequences ENSMUSP00000108790 XP_006498096.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]